PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS70356.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family GRAS
Protein Properties Length: 518aa    MW: 58013.9 Da    PI: 4.9235
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS70356.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS398.85.6e-1221415181374
        GRAS   1 lvelLlecAeavss.....gdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                 l+elL++cAe+v++     ++++ a  l+ +l++l+s  gdp+qRl ay++e+++arl++s+s +yk+l+++e  + +s++ ++++++ ++++P++kf+
  EPS70356.1 141 LKELLMACAEVVENvksshDEQQVAIDLMDKLEDLVSVCGDPLQRLGAYMLEGIRARLLESGSVIYKKLKCREPINPSSADLMSYMHVIYQICPYYKFA 239
                 5799*******998655556677999*************************************************999********************* PP

        GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                 ++     I ea++ e+ +HiiDf+i qG QW+++ q+ a R ++pp +RiTgv++p+s   +   l+ +g+rLa++A+++gvpfef+  +a + ++++ 
  EPS70356.1 240 YVSSTVIIDEATKDENSIHIIDFQIAQGSQWASFVQSVARR-RPPPFIRITGVDDPQSAhaRGGGLHLVGKRLADLADSCGVPFEFHG-AAINGTEVSR 336
                 **************************************988.899************99889999***********************.8999****** PP

        GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                 e++++++gEa+aVn+ + lh+++desv++e++rd++L+lvkslsP+vv++veqe+++n++sF +rf ealeyysa+f+s++a  pre++ ri+ E+ ++
  EPS70356.1 337 EDIEIRHGEAVAVNFPYVLHHMPDESVTTENHRDRLLHLVKSLSPRVVTLVEQESNTNTSSFRNRFREALEYYSAMFESIDAARPREDRMRISTEENCI 435
                 *************************************************************************************************** PP

        GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 +r+ivn+vaceg+er+erhe ++kWr+rl++aGF+pv+l++ a++ a  +l++++s+ yrv ee+g+l+l Wk+r++ ++SaWr
  EPS70356.1 436 ARDIVNIVACEGRERVERHEPFGKWRMRLSMAGFSPVRLDQAAENAAVEMLKEYSSN-YRVGEENGALYLWWKERAMSTCSAWR 518
                 *******************************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.053115499IPR005202Transcription factor GRAS
PfamPF035141.9E-119141518IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
YNQPVAERRP YASPNSQIKI SDDADGQERY FTLESSPAIN FGSSSSAVIS SIRSPFSPQG  60
SQYSCTSDYH QSSDITTATT YCSSPGSGSS GNVDVNKWIY ALQALSNELL GPEMDIDDGC  120
SFEDPRSSYA EILERAPGMD LKELLMACAE VVENVKSSHD EQQVAIDLMD KLEDLVSVCG  180
DPLQRLGAYM LEGIRARLLE SGSVIYKKLK CREPINPSSA DLMSYMHVIY QICPYYKFAY  240
VSSTVIIDEA TKDENSIHII DFQIAQGSQW ASFVQSVARR RPPPFIRITG VDDPQSAHAR  300
GGGLHLVGKR LADLADSCGV PFEFHGAAIN GTEVSREDIE IRHGEAVAVN FPYVLHHMPD  360
ESVTTENHRD RLLHLVKSLS PRVVTLVEQE SNTNTSSFRN RFREALEYYS AMFESIDAAR  420
PREDRMRIST EENCIARDIV NIVACEGRER VERHEPFGKW RMRLSMAGFS PVRLDQAAEN  480
AAVEMLKEYS SNYRVGEENG ALYLWWKERA MSTCSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-5117951836375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012849068.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLS8CZ900.0S8CZ90_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc11g012510.1.10.0(Solanum lycopersicum)
STRINGPGSC0003DMT4000347630.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.11e-175SCARECROW-like 13
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]